Danish
Uniprot ID:  P02095
  • Protein: Hemoglobin subunit beta
  • Organism: Guinea pig (Cavia porcellus)
  • Length: 146
  • Sequence:
    • VHLTAAEKSAILDLWGKVNVGEIGAEALGRLLVVYPWTQRFFEKFGDLSSASAIMSNAHVKSHGAKVLASFSEGLKHLQDLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIALAHHHPSEFTPCTQAAFQKVTAGVANALAHKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003hyu , Chain B 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-146 (1-146), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003hyu , Chain B-1 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-146 (1-146), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00003a0g , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-144 (1-146), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) I110L, V111T, L114I
Insertions None
Deletions None
Sequence identity to UniProt 0.9795
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003a0g , Chain B-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-144 (1-146), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) I110L, V111T, L114I
Insertions None
Deletions None
Sequence identity to UniProt 0.9795
auth_asym_id B
label_asym_ids of heme E-1
Available structure PDB