Danish
Uniprot ID:  P02141
  • Protein: Hemoglobin subunit beta-4
  • Organism: Rainbow trout (Oncorhynchus mykiss)
  • Length: 148
  • Sequence:
    • MVDWTDPERSAIVGLWGKISVDEIGPQALARLLIVSPWTQRHFSTFGNLSTPAAIMGNPAVAKHGKTVMHGLDRAVQNLDDIKNTYTALSVMHSEKLHVDPDNFRLLADCITVCVAAKLGPAVFSADTQEAFQKFLAVVVSALGRQYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003bom , Chain B 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) P7A, T87V, A88T, H98F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9728
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003bom , Chain D 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) P7A, T87V, A88T, H98F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9728
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00002r1h , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) P7A, T87V, A88T, H98F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9728
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002r1h , Chain D 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) P7A, T87V, A88T, H98F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9728
auth_asym_id D
label_asym_ids of heme L
Available structure PDB