Danish
Uniprot ID:  P02189
  • Protein: Myoglobin
  • Organism: Pig (Sus scrofa)
  • Length: 154
  • Sequence:
    • MGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  33
PDB ID:  pdb_00001mwc , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mwc , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001myg , Chain A 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001myg , Chain B 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001m6m , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001m6m , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001mwd , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mwd , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001m6c , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001m6c , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001myh , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K46R
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001myh , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K46R
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001myj , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001myj , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001mno , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mno , Chain B 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001mdn , Chain A 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mdn , Chain B 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V69N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001myi , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K46S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001myi , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K46S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001mni , Chain A 
Resolution 2.07 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) H65V, V69H
Insertions None
Deletions M1
Sequence identity to UniProt 0.9869
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mni , Chain B 
Resolution 2.07 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) H65V, V69H
Insertions None
Deletions M1
Sequence identity to UniProt 0.9869
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001ycb , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001ycb , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001mnj , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) H65V, V69I
Insertions None
Deletions M1
Sequence identity to UniProt 0.9869
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mnj , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-151 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) H65V, V69I
Insertions None
Deletions M1
Sequence identity to UniProt 0.9869
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001mnk , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-151 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) H65V, V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9869
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mnk , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-151 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) H65V, V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9869
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001mnh , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) H65V, T68R
Insertions None
Deletions M1
Sequence identity to UniProt 0.9869
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001pmb , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001pmb , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001yca , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001yca , Chain B 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-153 (2-154), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V69T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9935
auth_asym_id B
label_asym_ids of heme E
Available structure PDB