Danish
Uniprot ID:  P02229
  • Protein: Globin CTT-III
  • Organism: Midge (Chironomus thummi thummi)
  • Length: 151
  • Sequence:
    • MKFLILALCFAAASALSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFEIHANRIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSKM
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001eca , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-136 (16-151), 0.90
Mutations (UniProt numbering) I72T
Insertions None
Deletions M1-A15
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001ecd , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-136 (16-151), 0.90
Mutations (UniProt numbering) I72T
Insertions None
Deletions M1-A15
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001ecn , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-136 (16-151), 0.90
Mutations (UniProt numbering) I72T
Insertions None
Deletions M1-A15
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001eco , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-136 (16-151), 0.90
Mutations (UniProt numbering) I72T
Insertions None
Deletions M1-A15
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme B
Available structure PDB