Danish
Uniprot ID:  P05181
  • Protein: Cytochrome P450 2E1
  • Organism: Human (Homo sapiens)
  • Length: 493
  • Sequence:
    • MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  14
PDB ID:  pdb_00003e6i , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id A
Missing residues 138MET-138MET
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00003e6i , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id B
Missing residues 138MET-139GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00003t3z , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003t3z , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003t3z , Chain C 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003t3z , Chain D 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003e4e , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 31-494 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id A
Missing residues 138MET-140LYS
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003e4e , Chain B 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 31-494 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id B
Missing residues 138MET-140LYS
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00003gph , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id A
Missing residues 138MET-139GLY
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00003gph , Chain B 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id B
Missing residues 138MET-139GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00003koh , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003koh , Chain B 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003lc4 , Chain A 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id A
Missing residues 139GLY-141GLN
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00003lc4 , Chain B 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 31-493 (32-493), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W23A, R24K, Q25K, V26T, H27S, S29K, W30G, N31K
Insertions 493insHHHH
Deletions M1-S21
Sequence identity to UniProt 0.9831
auth_asym_id B
Missing residues 138MET-141GLN
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å