Danish
Uniprot ID:  P07803
  • Protein: Anaerobic nitrite reductase GLB1
  • Organism: Peach-leaf poison-bush (Trema tomentosum)
  • Length: 161
  • Sequence:
    • MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFETRFALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAIKSEMKPSST
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003qqq , Chain A 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 9-159 (1-116), 1.00
Difference from Uniprot sequence expression tag:SEE REMARK 999
Mutations (UniProt numbering) None
Insertions 0insHHHHHH, 116insV
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 56ASP-56ASP
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00003qqq , Chain B 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 9-159 (1-116), 1.00
Difference from Uniprot sequence expression tag:SEE REMARK 999
Mutations (UniProt numbering) None
Insertions 0insHHHHHH, 116insV
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 56ASP-57SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.19 Å