Danish
Uniprot ID:  P08197
  • Protein: Cytochrome c6, chloroplastic
  • Organism: Chlamydomonas smithii (Chlamydomonas reinhardtii)
  • Length: 148
  • Sequence:
    • MLQLANRSVRAKAARASQSARSVSCAAAKRGADVAPLTSALAVTASILLTTGAASASAADLALGAQVFNGNCAACHMGGRNSVMPEKTLDKAALEQYLDGGFKVESIIYQVENGKGAMPAWADRLSEEEIQAVAEYVFKQATDAAWKY
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00001cyi , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-89 (59-148), 0.61
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A58
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001cyj , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-90 (59-148), 0.61
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A58
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00009se7 , Chain H 
Residue indices (Uniprot), coverage 1-89 (59-147), 0.60
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A58, Y148
Sequence identity to UniProt 1.0000
auth_asym_id T
label_asym_ids of heme WD
Available structure PDB