Danish

Uniprot ID: P09787

Protein: 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit
Organism: Arthrobacter siderocapsulatus (Pseudomonas putida)
Length: 113
Sequence:

MTFPFSGAAVKRMLVTGVVLPFGLLVAAGQAQADSQWGSGKNLYDKVCGHCHKPEVGVGPVLEGRGLPEAYIKDIVRNGFRAMPAFPASYVDDESLTQVAEYLSSLPAPAAQP

Number of chains: 6

PDB ID: 1wve , Chain B
Resolution	1.85 Å
Residue indices (Uniprot), coverage	602-676 (34-113), 0.71
auth_asym_id	C
label_asym_ids of heme	L
Available structure	PDB

PDB ID: 1wve , Chain D
Resolution	1.85 Å
Residue indices (Uniprot), coverage	602-676 (34-113), 0.71
auth_asym_id	D
label_asym_ids of heme	R
Available structure	PDB

PDB ID: 1dii , Chain B
Resolution	2.50 Å
Residue indices (Uniprot), coverage	602-674 (34-113), 0.71
auth_asym_id	C
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 1dii , Chain D
Resolution	2.50 Å
Residue indices (Uniprot), coverage	602-674 (34-113), 0.71
auth_asym_id	D
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 1diq , Chain B
Resolution	2.75 Å
Residue indices (Uniprot), coverage	602-675 (34-113), 0.71
auth_asym_id	C
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 1diq , Chain D
Resolution	2.75 Å
Residue indices (Uniprot), coverage	602-675 (34-113), 0.71
auth_asym_id	D
label_asym_ids of heme	L
Available structure	PDB