Danish
Uniprot ID:  P0A004
  • Protein: Nitric oxide synthase oxygenase
  • Organism: Staphylococcus aureus
  • Length: 358
  • Sequence:
    • MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNNQLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001mjt , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-346 (2-346), 0.97
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1H
Insertions 0insH
Deletions K347-H358
Sequence identity to UniProt 0.9971
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001mjt , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 0-346 (2-346), 0.97
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1H
Insertions 0insH
Deletions K347-H358
Sequence identity to UniProt 0.9971
auth_asym_id B
label_asym_ids of heme I
Available structure PDB