Danish
Uniprot ID:  P0A384
  • Protein: Cytochrome b6
  • Organism: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
  • Length: 215
  • Sequence:
    • MANVYDWFEERLEIQAIAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00004ogq , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 2-215 (1-215), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme J ,  I
Available structure PDB
PDB ID:  pdb_00004ogq , Chain A-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 2-215 (1-215), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme J-1 ,  I-1
Available structure PDB
PDB ID:  pdb_00004h44 , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-215 (1-215), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme J ,  I
Available structure PDB
PDB ID:  pdb_00004h44 , Chain A-1 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-215 (1-215), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme J-1 ,  I-1
Available structure PDB
PDB ID:  pdb_00002zt9 , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-215 (1-215), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme J ,  I
Available structure PDB
PDB ID:  pdb_00002zt9 , Chain A-1 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-215 (1-215), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme J-1 ,  I-1
Available structure PDB