Danish
Uniprot ID:  P0A3X7
  • Protein: Cytochrome c6
  • Organism: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
  • Length: 111
  • Sequence:
    • MKKIFSLVLLGIALFTFAFSSPALAADSVNGAKIFSANCASCHAGGKNLVQAQKTLKKADLEKYGMYSAEAIIAQVTNGKNAMPAFKGRLKPEQIEDVAAYVLGKADADWK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  14
PDB ID:  pdb_00004gyd , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00004gyd , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00004gyd , Chain C 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00004gyd , Chain D 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00004gyd , Chain E 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004gyd , Chain F 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00004h0k , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83H
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004h0k , Chain B 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 2-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83H
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00004h0j , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83C
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00004h0j , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83C
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00004h0j , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83C
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00004h0j , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83C
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id D
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00004h0j , Chain E 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83C
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id E
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004h0j , Chain F 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83C
Insertions None
Deletions M1-A25
Sequence identity to UniProt 0.9884
auth_asym_id F
label_asym_ids of heme L
Available structure PDB