Danish

Uniprot ID: P0A3X9

Protein: Cytochrome c6
Organism:
Length: 112
Sequence:

MKKRFISVCAIAIALLVSLTPAALAADLANGAKVFSGNCAACHMGGGNVVMANKTLKKEALEQFGMYSEDAIIYQVQHGKNAMPAFAGRLTDEQIQDVAAYVLDQAAKGWAG

Number of chains: 9

PDB ID: 6tr1 , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-86 (26-111), 0.77
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 6tr1 , Chain B
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-87 (26-112), 0.78
auth_asym_id	C
Nonstandard amino acids	MEN
label_asym_ids of heme	F
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 6tr1 , Chain C
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-86 (26-111), 0.77
Difference from Uniprot sequence	conflict
auth_asym_id	E
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 6tsy , Chain A
Resolution	2.25 Å
Residue indices (Uniprot), coverage	26-111 (26-112), 0.78
auth_asym_id	A
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 6tsy , Chain B
Resolution	2.25 Å
Residue indices (Uniprot), coverage	26-112 (26-112), 0.78
auth_asym_id	B
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 6tsy , Chain C
Resolution	2.25 Å
Residue indices (Uniprot), coverage	26-110 (26-112), 0.78
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 6tsy , Chain D
Resolution	2.25 Å
Residue indices (Uniprot), coverage	26-111 (26-112), 0.78
auth_asym_id	D
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 6tsy , Chain E
Resolution	2.25 Å
Residue indices (Uniprot), coverage	26-110 (26-112), 0.78
auth_asym_id	E
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 6tsy , Chain F
Resolution	2.25 Å
Residue indices (Uniprot), coverage	26-111 (26-112), 0.78
auth_asym_id	F
label_asym_ids of heme	M
Available structure	PDB