Danish
Uniprot ID:  P0A901
  • Protein: Outer membrane lipoprotein Blc
  • Organism: Escherichia coli (strain K12)
  • Length: 177
  • Sequence:
    • MRLLPLVAAATAAFLVVACSSPTPPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGLEKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPGS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  12
PDB ID:  pdb_00006vri , Chain A 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 23-109 (23-109), 0.60
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) L4G, P5H, L6H, V7H, A8H, A9H, A10H, T11L, A12E, A13S, F14T, L15S, V16L, V17Y, A18K, C19K, P22S
Insertions None
Deletions R2-L3, G110-S177
Sequence identity to UniProt 0.8411
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006vri , Chain B 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 112-175 (109-177), 0.39
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) None
Insertions None
Deletions R2-F109
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006vri , Chain C 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 24-109 (23-109), 0.60
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) L4G, P5H, L6H, V7H, A8H, A9H, A10H, T11L, A12E, A13S, F14T, L15S, V16L, V17Y, A18K, C19K, P22S
Insertions None
Deletions R2-L3, G110-S177
Sequence identity to UniProt 0.8411
auth_asym_id C
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006vri , Chain D 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 110-177 (109-177), 0.39
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) None
Insertions None
Deletions R2-F109
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006vri , Chain E 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 24-109 (23-109), 0.60
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) L4G, P5H, L6H, V7H, A8H, A9H, A10H, T11L, A12E, A13S, F14T, L15S, V16L, V17Y, A18K, C19K, P22S
Insertions None
Deletions R2-L3, G110-S177
Sequence identity to UniProt 0.8411
auth_asym_id E
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006vri , Chain F 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 112-177 (109-177), 0.39
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) None
Insertions None
Deletions R2-F109
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006ukl , Chain A 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 23-109 (23-109), 0.60
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) L4G, P5H, L6H, V7H, A8H, A9H, A10H, T11L, A12E, A13S, F14T, L15S, V16L, V17Y, A18K, C19K, P22S, A36C
Insertions None
Deletions R2-L3, G110-S177
Sequence identity to UniProt 0.8318
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006ukl , Chain B 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 24-109 (23-109), 0.60
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) L4G, P5H, L6H, V7H, A8H, A9H, A10H, T11L, A12E, A13S, F14T, L15S, V16L, V17Y, A18K, C19K, P22S, A36C
Insertions None
Deletions R2-L3, G110-S177
Sequence identity to UniProt 0.8318
auth_asym_id C
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006ukl , Chain C 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 23-109 (23-109), 0.60
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) L4G, P5H, L6H, V7H, A8H, A9H, A10H, T11L, A12E, A13S, F14T, L15S, V16L, V17Y, A18K, C19K, P22S, A36C
Insertions None
Deletions R2-L3, G110-S177
Sequence identity to UniProt 0.8318
auth_asym_id E
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00006ukl , Chain D 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 110-177 (109-177), 0.39
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) None
Insertions None
Deletions R2-F109
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00006ukl , Chain E 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 112-177 (109-177), 0.39
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) None
Insertions None
Deletions R2-F109
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00006ukl , Chain F 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 114-176 (109-177), 0.39
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) None
Insertions None
Deletions R2-F109
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme None
Available structure PDB