Danish
Uniprot ID:  P0ABE7
  • Protein: Soluble cytochrome b562
  • Organism: Escherichia coli
  • Length: 128
  • Sequence:
    • MRKSLLAILAVSSLVFSSASFAADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  369
PDB ID:  pdb_00006dyf , Chain A 
Resolution 1.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006dyf , Chain B 
Resolution 1.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00004jea , Chain A 
Resolution 1.22 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00004jea , Chain B 
Resolution 1.22 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00004jea , Chain C 
Resolution 1.22 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004jea , Chain D 
Resolution 1.22 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00007lsj , Chain A 
Resolution 1.26 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, H85A, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lsj , Chain B 
Resolution 1.26 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, H85A, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00007mk4 , Chain A 
Resolution 1.27 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007mk4 , Chain B 
Resolution 1.27 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dyc , Chain A 
Resolution 1.33 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006dyc , Chain B 
Resolution 1.33 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_0000256b , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_0000256b , Chain B 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain A-1 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id A
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain A-2 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id A
label_asym_ids of heme E-2
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain B 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain B-1 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id B
label_asym_ids of heme L-1
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain B-2 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id B
label_asym_ids of heme L-2
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain C 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id C
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain C-1 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id C
label_asym_ids of heme R-1
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain C-2 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id C
label_asym_ids of heme R-2
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain D 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id D
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain D-1 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id D
label_asym_ids of heme W-1
Available structure PDB
PDB ID:  pdb_00006ot4 , Chain D-2 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8113
auth_asym_id D
label_asym_ids of heme W-2
Available structure PDB
PDB ID:  pdb_00007lrv , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lrv , Chain B 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dyg , Chain A 
Resolution 1.49 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006dyg , Chain B 
Resolution 1.49 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006ot8 , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D24E, D27E, E30H, V38H, Q47E, R56Q, L60Q, Q63W, K64S, K81S, H85S, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006ot8 , Chain A-1 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D24E, D27E, E30H, V38H, Q47E, R56Q, L60Q, Q63W, K64S, K81S, H85S, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006ot8 , Chain A-2 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D24E, D27E, E30H, V38H, Q47E, R56Q, L60Q, Q63W, K64S, K81S, H85S, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme B-2
Available structure PDB
PDB ID:  pdb_00006ot8 , Chain A-3 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D24E, D27E, E30H, V38H, Q47E, R56Q, L60Q, Q63W, K64S, K81S, H85S, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme B-3
Available structure PDB
PDB ID:  pdb_00006ot8 , Chain A-4 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D24E, D27E, E30H, V38H, Q47E, R56Q, L60Q, Q63W, K64S, K81S, H85S, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme B-4
Available structure PDB
PDB ID:  pdb_00006ot8 , Chain A-5 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D24E, D27E, E30H, V38H, Q47E, R56Q, L60Q, Q63W, K64S, K81S, H85S, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme B-5
Available structure PDB
PDB ID:  pdb_00007lsn , Chain A 
Resolution 1.52 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, H85A, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lsn , Chain B 
Resolution 1.52 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, H85A, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00008drm , Chain A 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00008drm , Chain A-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00007rwx , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00007rwx , Chain A-1 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00007rwx , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00007rwx , Chain B-1 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme H-1
Available structure PDB
PDB ID:  pdb_00007lsl , Chain A 
Resolution 1.64 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, H85A, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lsl , Chain B 
Resolution 1.64 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, H85A, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00008drl , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00008drl , Chain A-1 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006wz0 , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q63K, D76A, K81I, H85V, V91L, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006wz0 , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q63K, D76A, K81I, H85V, V91L, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006wz0 , Chain C 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q63K, D76A, K81I, H85V, V91L, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id C
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00007lr5 , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lr5 , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007lra , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lra , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007rww , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00007rww , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00007rww , Chain C 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00007rww , Chain D 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00008drf , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00008drf , Chain A-1 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00003de8 , Chain A 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id A
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00003de8 , Chain B 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id B
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003de8 , Chain C 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id C
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003de8 , Chain D 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id D
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00006dyd , Chain A 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dyd , Chain B 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003c63 , Chain A 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56K, K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003c63 , Chain B 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56K, K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00003c63 , Chain C 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56K, K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id C
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00003c63 , Chain D 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56K, K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id D
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00006wyu , Chain A 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q63K, D76A, K81I, H85V, V91L, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006wyu , Chain B 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q63K, D76A, K81I, H85V, V91L, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006wyu , Chain C 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q63K, D76A, K81I, H85V, V91L, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00007lrb , Chain A 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lrb , Chain B 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dy6 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dy6 , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006wz3 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006wz3 , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00006wz3 , Chain C 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00007n4f , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9151
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007n4f , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9151
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00007rwu , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00007rwu , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00007rwu , Chain A-2 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F-2
Available structure PDB
PDB ID:  pdb_00006ai5 , Chain A 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006ai5 , Chain B 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00006ai5 , Chain C 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id E
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00006ai5 , Chain D 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id G
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00006dyh , Chain A 
Resolution 1.83 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006dyh , Chain B 
Resolution 1.83 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id D
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005awi , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9811
auth_asym_id A
label_asym_ids of heme J ,  C
Available structure PDB
PDB ID:  pdb_00005awi , Chain B 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9811
auth_asym_id B
label_asym_ids of heme J ,  C
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id D
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain A-1 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id D
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain A-2 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id D
label_asym_ids of heme E-2
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain B 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain B-1 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme M-1
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain B-2 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme M-2
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain C 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id B
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain C-1 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id B
label_asym_ids of heme T-1
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain C-2 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id B
label_asym_ids of heme T-2
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain D 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id C
label_asym_ids of heme X
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain D-1 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id C
label_asym_ids of heme X-1
Available structure PDB
PDB ID:  pdb_00006ot7 , Chain D-2 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id C
label_asym_ids of heme X-2
Available structure PDB
PDB ID:  pdb_00003c62 , Chain A 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003c62 , Chain B 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00003c62 , Chain C 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id C
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00003c62 , Chain D 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, R84D, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id D
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00007lrr , Chain A 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lrr , Chain B 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00008drd , Chain A 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008drd , Chain B 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003m4c , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003m4c , Chain A-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00003m4c , Chain A-2 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme F-2
Available structure PDB
PDB ID:  pdb_00003m4c , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme X ,  K
Available structure PDB
PDB ID:  pdb_00003m4c , Chain B-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme X-1 ,  K-1
Available structure PDB
PDB ID:  pdb_00003m4c , Chain B-2 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme X-2 ,  K-2
Available structure PDB
PDB ID:  pdb_00003m4c , Chain C 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00003m4c , Chain C-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme R-1
Available structure PDB
PDB ID:  pdb_00003m4c , Chain C-2 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme R-2
Available structure PDB
PDB ID:  pdb_00003m4c , Chain D 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00003m4c , Chain D-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme T-1
Available structure PDB
PDB ID:  pdb_00003m4c , Chain D-2 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme T-2
Available structure PDB
PDB ID:  pdb_00006dy4 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006dy4 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id D
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006dy8 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dy8 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006dy8 , Chain C 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006dy8 , Chain D 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, G92Y, Q93H, T118C, T119E, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id D
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00007lv1 , Chain A 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lv1 , Chain B 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00007n4g , Chain A 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9151
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007n4g , Chain B 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9151
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006dyi , Chain A 
Resolution 1.96 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, I89H, Q93H, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id B
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005xzj , Chain A 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005xzj , Chain B 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00005xzj , Chain C 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id C
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00005xzj , Chain D 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id D
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00007lv4 , Chain A 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007lv4 , Chain B 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, I89H, Q93H, T118C, T119H, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9057
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006x7e , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006x7e , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006x7e , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id C
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00006wz1 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006wz1 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006wz1 , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003hnj , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89L, V91I, Q93A, D95H, K99H, A111K, Q115L, T118A, T119I, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8396
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003hnj , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89L, V91I, Q93A, D95H, K99H, A111K, Q115L, T118A, T119I, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8396
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003hnj , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89L, V91I, Q93A, D95H, K99H, A111K, Q115L, T118A, T119I, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8396
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003hnj , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89L, V91I, Q93A, D95H, K99H, A111K, Q115L, T118A, T119I, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8396
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003tol , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003tol , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id C
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003tol , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003tol , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id B
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00007su2 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007su2 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00007su2 , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00007su2 , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id G
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006wz2 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006wz2 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006wz2 , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00003nmi , Chain A 
Resolution 2.01 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003nmi , Chain B 
Resolution 2.01 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003nmi , Chain C 
Resolution 2.01 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003nmi , Chain D 
Resolution 2.01 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id D
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00003nmi , Chain E 
Resolution 2.01 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id E
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00003nmi , Chain F 
Resolution 2.01 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id F
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00003de9 , Chain A 
Resolution 2.04 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003de9 , Chain A-1 
Resolution 2.04 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id A
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00003de9 , Chain A-2 
Resolution 2.04 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id A
label_asym_ids of heme E-2
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain A-1 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain B 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain B-1 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain C 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain C-1 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
label_asym_ids of heme G-1
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain D 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003iq5 , Chain D-1 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id D
label_asym_ids of heme H-1
Available structure PDB
PDB ID:  pdb_00003hnk , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003hnk , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003m79 , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003m79 , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003m79 , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003m79 , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003m79 , Chain E 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003m79 , Chain F 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id F
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00003m79 , Chain G 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id G
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00003m79 , Chain H 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id H
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00005l32 , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005l32 , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00005l32 , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00005l32 , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00004je9 , Chain A 
Resolution 2.12 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004je9 , Chain A-1 
Resolution 2.12 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00004je9 , Chain B 
Resolution 2.12 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00004je9 , Chain B-1 
Resolution 2.12 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme D-1
Available structure PDB
PDB ID:  pdb_00006wzc , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006wzc , Chain A-1 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006wzc , Chain A-2 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme B-2
Available structure PDB
PDB ID:  pdb_00003hnl , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003hnl , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00007rwv , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007rwv , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00007rwv , Chain C 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00007rwv , Chain D 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00007rwy , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00007rwy , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00007rwy , Chain C 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00007rwy , Chain D 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00007rwy , Chain E 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id E
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00007rwy , Chain F 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id F
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00006dhy , Chain A 
Resolution 2.22 Å
Residue indices (Uniprot), coverage 2-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dhy , Chain B 
Resolution 2.22 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006dhy , Chain C 
Resolution 2.22 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006dhy , Chain D 
Resolution 2.22 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id D
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00002bc5 , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9717
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002bc5 , Chain B 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9717
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00002bc5 , Chain C 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9717
auth_asym_id C
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00002bc5 , Chain D 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9717
auth_asym_id D
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00006dye , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006dye , Chain B 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003l1m , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, G92C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9623
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003l1m , Chain A-1 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, G92C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9623
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00003tom , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003tom , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003tom , Chain C 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00003tom , Chain D 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81R, D88A, V91M, D95H, L98A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id D
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00004jeb , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81A, D88W, V91I, D95H, D96A, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004jeb , Chain A-1 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81A, D88W, V91I, D95H, D96A, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00004jeb , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81A, D88W, V91I, D95H, D96A, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00004jeb , Chain B-1 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81A, D88W, V91I, D95H, D96A, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id B
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00006wz7 , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102E, E103K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8396
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006wz7 , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102E, E103K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8396
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00006wz7 , Chain C 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T53K, A57K, Q63K, D76A, K81I, H85V, I89E, V91A, G92W, Q93E, D95H, L98A, K99H, N102E, E103K, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8396
auth_asym_id C
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003hni , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003hni , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003hni , Chain C 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003hni , Chain D 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003hni , Chain E 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003hni , Chain F 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id F
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00003hni , Chain G 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id G
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00003hni , Chain H 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8962
auth_asym_id H
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain C 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain D 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain E 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain F 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id F
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain G 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id G
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00003iq6 , Chain H 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id H
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00003foo , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003foo , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003foo , Chain C 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id C
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00003foo , Chain D 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id D
label_asym_ids of heme Y
Available structure PDB
PDB ID:  pdb_00003foo , Chain E 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id E
label_asym_ids of heme CA
Available structure PDB
PDB ID:  pdb_00003foo , Chain F 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id F
label_asym_ids of heme GA
Available structure PDB
PDB ID:  pdb_00003foo , Chain G 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id G
label_asym_ids of heme KA
Available structure PDB
PDB ID:  pdb_00003foo , Chain H 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id H
label_asym_ids of heme OA
Available structure PDB
PDB ID:  pdb_00003foo , Chain I 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id I
label_asym_ids of heme SA
Available structure PDB
PDB ID:  pdb_00003foo , Chain J 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id J
label_asym_ids of heme WA
Available structure PDB
PDB ID:  pdb_00003foo , Chain K 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id K
label_asym_ids of heme AB
Available structure PDB
PDB ID:  pdb_00003foo , Chain L 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id L
label_asym_ids of heme EB
Available structure PDB
PDB ID:  pdb_00005l31 , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005l31 , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
Missing residues 38CYS-38CYS
Nonstandard amino acids CSO Structure of CSOCSO
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00005l31 , Chain C 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
Missing residues 47LYS-51LYS
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00005l31 , Chain D 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E103C, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id C
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain A-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id C
label_asym_ids of heme H-1
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain A-2 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id C
label_asym_ids of heme H-2
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain B-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id D
label_asym_ids of heme M-1
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain B-2 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id D
label_asym_ids of heme M-2
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain C 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id B
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain C-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id B
label_asym_ids of heme Q-1
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain C-2 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id B
label_asym_ids of heme Q-2
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain D 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id A
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain D-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id A
label_asym_ids of heme T-1
Available structure PDB
PDB ID:  pdb_00006ot9 , Chain D-2 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E30H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8208
auth_asym_id A
label_asym_ids of heme T-2
Available structure PDB
PDB ID:  pdb_00008drj , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) K81W, D82H, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id C
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008drj , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, D82H, Q93I, T118C, R120C, A122H, Y123C, K126H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9245
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00005bu7 , Chain A 
Resolution 2.46 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81H, D88A, V91M, D95H, L98A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005bu7 , Chain A-1 
Resolution 2.46 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81H, D88A, V91M, D95H, L98A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00005bu7 , Chain B 
Resolution 2.46 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81H, D88A, V91M, D95H, L98A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00005bu7 , Chain B-1 
Resolution 2.46 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K49E, D50K, T53E, R56L, L60A, Q63L, K81H, D88A, V91M, D95H, L98A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8585
auth_asym_id B
label_asym_ids of heme H-1
Available structure PDB
PDB ID:  pdb_00003m4b , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003m4b , Chain A-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00003m4b , Chain A-2 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E-2
Available structure PDB
PDB ID:  pdb_00003m4b , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003m4b , Chain B-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme K-1
Available structure PDB
PDB ID:  pdb_00003m4b , Chain B-2 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme K-2
Available structure PDB
PDB ID:  pdb_00003m4b , Chain C 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00003m4b , Chain C-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme R-1
Available structure PDB
PDB ID:  pdb_00003m4b , Chain C-2 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme R-2
Available structure PDB
PDB ID:  pdb_00003m4b , Chain D 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00003m4b , Chain D-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme T-1
Available structure PDB
PDB ID:  pdb_00003m4b , Chain D-2 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, I89C, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme T-2
Available structure PDB
PDB ID:  pdb_00004u9d , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00004u9d , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004u9d , Chain C 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id C
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00004u9d , Chain D 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8679
auth_asym_id D
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00006wza , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D88N, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006wza , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D88N, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006wza , Chain C 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D88N, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id C
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00006x8x , Chain A 
Resolution 2.51 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K81H, D88N, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006x8x , Chain A-1 
Resolution 2.51 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K81H, D88N, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006x8x , Chain A-2 
Resolution 2.51 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K81H, D88N, G92W, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme B-2
Available structure PDB
PDB ID:  pdb_00003m15 , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003m15 , Chain B 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003m15 , Chain C 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00005xzi , Chain A 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005xzi , Chain A-1 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005xzi , Chain A-2 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme B-2
Available structure PDB
PDB ID:  pdb_00005xzi , Chain A-3 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, E108D, A111E, Q115H, T118C, R120C, A122H, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
label_asym_ids of heme B-3
Available structure PDB
PDB ID:  pdb_00009tmp , Chain A 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 25-127 (1-128), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001lm3 , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) F83I, F87Y, R128L
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9717
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001lm3 , Chain B 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F83I, F87Y, R128L
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9717
auth_asym_id D
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00007tep , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007tep , Chain B 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00007tep , Chain C 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00007tep , Chain D 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, K81H, D88W, V91I, D95H, D96A, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8774
auth_asym_id D
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00003u8p , Chain A 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 3-339 (23-128), 1.00
Difference from Uniprot sequence chromophore:engineered mutation:expression tag:initiating methionine:linker
Mutations (UniProt numbering) R2K, K3G, S4E, L5E, A7F, I8T, L9G, A10V, S12P, S13I, F16D, S17A, S18T, A19F, S20G, F21G, A22S
Insertions 1insVS, 15insELDGDVNGHKFSVSGEGEG, 128insGGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Deletions None
Sequence identity to UniProt 0.8672
auth_asym_id A
Structural gaps Exists
Nonstandard amino acids CRO Structure of CROCRO
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003u8p , Chain B 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 3-338 (23-128), 1.00
Difference from Uniprot sequence chromophore:engineered mutation:expression tag:initiating methionine:linker
Mutations (UniProt numbering) R2K, K3G, S4E, L5E, A7F, I8T, L9G, A10V, S12P, S13I, F16D, S17A, S18T, A19F, S20G, F21G, A22S
Insertions 1insVS, 15insELDGDVNGHKFSVSGEGEG, 128insGGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Deletions None
Sequence identity to UniProt 0.8672
auth_asym_id B
Structural gaps Exists
Nonstandard amino acids CRO Structure of CROCRO
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003u8p , Chain C 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 3-338 (23-128), 1.00
Difference from Uniprot sequence chromophore:engineered mutation:expression tag:initiating methionine:linker
Mutations (UniProt numbering) R2K, K3G, S4E, L5E, A7F, I8T, L9G, A10V, S12P, S13I, F16D, S17A, S18T, A19F, S20G, F21G, A22S
Insertions 1insVS, 15insELDGDVNGHKFSVSGEGEG, 128insGGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Deletions None
Sequence identity to UniProt 0.8672
auth_asym_id C
Structural gaps Exists
Nonstandard amino acids CRO Structure of CROCRO
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006dyb , Chain A 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006dyb , Chain B 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) K81W, I89H, Q93H, T118C, T119H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id C
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003nmk , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003nmk , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003nmk , Chain C 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003nmk , Chain D 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00004u9e , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, E79G, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
Missing residues 43ALA-57GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.19 Å
PDB ID:  pdb_00004u9e , Chain A-1 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, E79G, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
Missing residues 43ALA-57GLY
Structural gaps Exists
label_asym_ids of heme B-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00004u9e , Chain A-2 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, E79G, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
Missing residues 43ALA-57GLY
Structural gaps Exists
label_asym_ids of heme B-2
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00004u9e , Chain A-3 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60A, Q63W, K64S, E79G, K81H, D88W, V91I, D95H, K99H, A111H, T118C, R120C, A122H, Y123C, K126A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8491
auth_asym_id A
Missing residues 43ALA-57GLY
Structural gaps Exists
label_asym_ids of heme B-3
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006dhz , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006dhz , Chain A-1 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id A
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00006dhz , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006dhz , Chain B-1 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id B
label_asym_ids of heme H-1
Available structure PDB
PDB ID:  pdb_00006dhz , Chain C 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
Missing residues 45PRO-51LYS
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00006dhz , Chain C-1 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id C
Missing residues 45PRO-51LYS
Structural gaps Exists
label_asym_ids of heme K-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00006dhz , Chain D 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id D
Missing residues 43ALA-49GLU
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00006dhz , Chain D-1 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R56A, L60C, Q63W, K64S, K81H, D88W, V91I, D95H, K99H, T118C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8868
auth_asym_id D
Missing residues 43ALA-49GLU
Structural gaps Exists
label_asym_ids of heme N-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002qla , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002qla , Chain B 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002qla , Chain C 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00002qla , Chain D 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81H, D95H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9528
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003fop , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003fop , Chain A-1 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00003fop , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88H, K99H, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9340
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003nmj , Chain A 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003nmj , Chain B 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003nmj , Chain C 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003nmj , Chain D 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K81C, R84A, H85A, D88A, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9434
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001qpu , Chain A 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001qq3 , Chain A 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R120C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9906
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006ovh , Chain A 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id A
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00006ovh , Chain B 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id B
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00006ovh , Chain C 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id C
label_asym_ids of heme AA
Available structure PDB
PDB ID:  pdb_00006ovh , Chain D 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id D
label_asym_ids of heme FA
Available structure PDB
PDB ID:  pdb_00006ovh , Chain E 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id E
label_asym_ids of heme MA
Available structure PDB
PDB ID:  pdb_00006ovh , Chain F 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id F
label_asym_ids of heme TA
Available structure PDB
PDB ID:  pdb_00006ovh , Chain G 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id G
label_asym_ids of heme XA
Available structure PDB
PDB ID:  pdb_00006ovh , Chain H 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id H
label_asym_ids of heme CB
Available structure PDB
PDB ID:  pdb_00006ovh , Chain I 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id I
label_asym_ids of heme HB
Available structure PDB
PDB ID:  pdb_00006ovh , Chain J 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id J
label_asym_ids of heme OB
Available structure PDB
PDB ID:  pdb_00006ovh , Chain K 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id K
label_asym_ids of heme TB
Available structure PDB
PDB ID:  pdb_00006ovh , Chain L 
Residue indices (Uniprot), coverage 1-106 (23-128), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) D27H, E30H, V38H, A46T, Q47T, R56Q, L60Q, Q63W, K64S, K81S, H85C, D88W, I89E, V91I, D95N, D96A, K99H, N102K, E103Q, G104C, R120C, Y123C
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.7925
auth_asym_id L
label_asym_ids of heme YB
Available structure PDB