Danish
Uniprot ID:  P0C189
  • Protein: Cytochrome c2
  • Organism: Rhodospirillum rubrum
  • Length: 112
  • Sequence:
    • EGDAAAGEKVSKKCLACHTFDQGGANKVGPNLFGVFENTAAHKDNYAYSESYTEMKAKGLTWTEANLAAYVKNPKAFVLEKSGDPKAKSKMTFKLTKDDEIENVIAYLKTLK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003c2c , Chain A 
Resolution 1.68 Å
Residue indices (Uniprot), coverage 1-112 (1-112), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002c2c , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-112 (1-112), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB