Danish
Uniprot ID:  P0C368
  • Protein: Cytochrome b559 subunit alpha
  • Organism: Rice (Oryza sativa)
  • Length: 83
  • Sequence:
    • MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITDRFDSLEQLDEFSRSF
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00009xk4 , Chain E 
Resolution 2.78 Å
Residue indices (Uniprot), coverage 8-82 (8-82), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E7, F83
Sequence identity to UniProt 1.0000
auth_asym_id 1e
label_asym_ids of heme VC
Available structure PDB
PDB ID:  pdb_000021wv , Chain WA 
Resolution 2.89 Å
Residue indices (Uniprot), coverage 8-82 (8-82), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E7, F83
Sequence identity to UniProt 1.0000
auth_asym_id 1e
label_asym_ids of heme IR
Available structure PDB
PDB ID:  pdb_000021wv , Chain X 
Resolution 2.89 Å
Residue indices (Uniprot), coverage 8-82 (8-82), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E7, F83
Sequence identity to UniProt 1.0000
auth_asym_id 1E
label_asym_ids of heme VK
Available structure PDB
PDB ID:  pdb_00009xk3 , Chain E 
Residue indices (Uniprot), coverage 8-82 (8-82), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E7, F83
Sequence identity to UniProt 1.0000
auth_asym_id 1E
label_asym_ids of heme VC
Available structure PDB