Danish
Uniprot ID:  P0CH25
  • Protein: Hemoglobin subunit alpha-1
  • Organism: Goat (Capra hircus)
  • Length: 142
  • Sequence:
    • MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGEKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTPAVHASLDKFLANVSTVLTSKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00003d1a , Chain A 
Resolution 2.61 Å
Residue indices (Uniprot), coverage 1-141 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003d1a , Chain C 
Resolution 2.61 Å
Residue indices (Uniprot), coverage 1-141 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002ri4 , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-139 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00002ri4 , Chain C 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 2-139 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00002ri4 , Chain E 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-138 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id I
Missing residues 89HIS-89HIS
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00002ri4 , Chain G 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 2-139 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id K
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003eu1 , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003eu1 , Chain C 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB