Danish
Uniprot ID:  P10613
  • Protein: Lanosterol 14-alpha demethylase
  • Organism: Yeast (Candida albicans (strain SC5314 / ATCC MYA-2876))
  • Length: 528
  • Sequence:
    • MAIVETVIDGINYFLSLSVTQQISILLGVPFVYNLVWQYLYSLRKDRAPLVFYWIPWFGSAASYGQQPYEFFESCRQKYGDVFSFMLLGKIMTVYLGPKGHEFVFNAKLSDVSAEDAYKHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTDSFKRYVPKIREEILNYFVTDESFKLKEKTHGVANVMKTQPEITIFTASRSLFGDEMRRIFDRSFAQLYSDLDKGFTPINFVFPNLPLPHYWRRDAAQKKISATYMKEIKSRRERGDIDPNRDLIDSLLIHSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFLLHLGEKPHLQDVIYQEVVELLKEKGGDLNDLTYEDLQKLPSVNNTIKETLRMHMPLHSIFRKVTNPLRIPETNYIVPKGHYVLVSPGYAHTSERYFDNPEDFDPTRWDTAAAKANSVSFNSSDEVDYGFGKVSKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTFVYNLRWTIDGYKVPDPDYSSMVVLPTEPAEIIWEKRETCMF
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  5
PDB ID:  pdb_00005tz1 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 45-528 (48-528), 0.92
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D46K, R47T, A48P, D116E, K128T, S263L
Insertions 528insHHHH
Deletions I3-R44
Sequence identity to UniProt 0.9877
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005tz1 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 45-528 (48-528), 0.92
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D46K, R47T, A48P, D116E, K128T, S263L
Insertions 528insHHHH
Deletions I3-R44
Sequence identity to UniProt 0.9877
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005fsa , Chain A 
Resolution 2.86 Å
Residue indices (Uniprot), coverage 45-528 (49-528), 0.92
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D46K, R47T, A48P, D116E, K128T, S263L
Insertions 528insHHHH
Deletions I3-R44
Sequence identity to UniProt 0.9877
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005fsa , Chain B 
Resolution 2.86 Å
Residue indices (Uniprot), coverage 46-528 (49-528), 0.92
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D46K, R47T, A48P, D116E, K128T, S263L
Insertions 528insHHHH
Deletions I3-R44
Sequence identity to UniProt 0.9877
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005v5z , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 25-524 (1-528), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 528insGGRHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 430ALA-441SER
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å