Danish
Uniprot ID:  P10780
  • Protein: Hemoglobin subunit alpha-A
  • Organism: Great cormorant (Phalacrocorax carbo)
  • Length: 141
  • Sequence:
    • VLSASDKTNVKGVFAKVGGSAEAYGAETLERMFTAYPQTKTYFPHFDLHHGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAIHHPTLLTPEVHASLDKFMCAVAKELTAKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003wr1 , Chain A 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003wr1 , Chain A-1 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB