Danish
Uniprot ID:  P11069
  • Protein: Extracellular globin-3
  • Organism: Common earthworm (Lumbricus terrestris)
  • Length: 170
  • Sequence:
    • MLRQLLVLVGLAVVCLADEHEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPDVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLNA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  42
PDB ID:  pdb_00001x9f , Chain C 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
Structural gaps Exists
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00001x9f , Chain G 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme AA
Available structure PDB
PDB ID:  pdb_00001x9f , Chain K 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme JA
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-1 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-1
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-10 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-10
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-11 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-11
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-2 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-2
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-3 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-3
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-4 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-4
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-5 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-5
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-6 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-6
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-7 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-7
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-8 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-8
Available structure PDB
PDB ID:  pdb_00002gtl , Chain C-9 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme U-9
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-1 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-1
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-10 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-10
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-11 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-11
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-2 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-2
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-3 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-3
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-4 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-4
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-5 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-5
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-6 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-6
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-7 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-7
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-8 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-8
Available structure PDB
PDB ID:  pdb_00002gtl , Chain G-9 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme CA-9
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-1 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-1
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-10 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-10
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-11 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-11
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-2 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-2
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-3 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-3
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-4 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-4
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-5 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-5
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-6 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-6
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-7 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-7
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-8 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-8
Available structure PDB
PDB ID:  pdb_00002gtl , Chain K-9 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme KA-9
Available structure PDB
PDB ID:  pdb_00005m3l , Chain C 
Resolution 3.80 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id C
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00005m3l , Chain G 
Resolution 3.80 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id G
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00005m3l , Chain K 
Resolution 3.80 Å
Residue indices (Uniprot), coverage 3-151 (18-170), 0.90
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D66E
Insertions None
Deletions M1-A17
Sequence identity to UniProt 0.9935
auth_asym_id K
label_asym_ids of heme Z
Available structure PDB