Danish
Uniprot ID:  P11542
  • Protein: Ligninase H2
  • Organism: White-rot fungus (Phanerodontia chrysosporium)
  • Length: 372
  • Sequence:
    • MAFKQLLAALSVALTLQVTQAAPNLDKRVACPDGVHTASNAACCAWFPVLDDIQQNLFHGGQCGAEAHEALRMVFHDSIAISPKLQSQGKFGGGGADGSIITFSSIETTYHPNIGLDEVVAIQKPFIAKHGVTRGDFIAFAGAVGVSNCPGAPQMQFFLGRPEATQAAPDGLVPEPFHTIDQVLARMLDAGGFDEIETVWLLSAHSIAAANDVDPTISGLPFDSTPGQFDSQFFVETQLRGTAFPGKTGIQGTVMSPLKGEMRLQTDHLFARDSRTACEWQSFVNNQTKLQEDFQFIFTALSTLGHDMNAMTDCSEVIPAPKPVNFGPSFFPAGKTHADIEQACASTPFPTLITAPGPSASVARIPPPPSPN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001qpa , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 0-345 (29-372), 0.92
Difference from Uniprot sequence conflict:modified residue
Mutations (UniProt numbering) R134P, T312I
Insertions 372insW
Deletions M1-R28
Sequence identity to UniProt 0.9942
auth_asym_id A
Missing residues 171TRP-171TRP
Structural gaps Exists
Nonstandard amino acids HTR Structure of HTRHTR
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00001qpa , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 0-345 (29-372), 0.92
Difference from Uniprot sequence conflict:modified residue
Mutations (UniProt numbering) R134P, T312I
Insertions 372insW
Deletions M1-R28
Sequence identity to UniProt 0.9942
auth_asym_id B
Missing residues 171TRP-171TRP
Structural gaps Exists
Nonstandard amino acids HTR Structure of HTRHTR
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å