Danish
Uniprot ID:  P11732
  • Protein: Cytochrome c5
  • Organism: Azotobacter vinelandii
  • Length: 83
  • Sequence:
    • GGGARSGDDVVAKYCNACHGTGLLNAPKVGDSAAWKTRADAKGGLDGLLAQSLSGLNAMPPKGTCADCSDDELKAAIGKMSGL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001cc5 , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 5-87 (1-83), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001cc5 , Chain A-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 5-87 (1-83), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB