Danish
Uniprot ID:  P14527
  • Protein: Hemoglobin subunit alpha-4
  • Organism: Rainbow trout (Oncorhynchus mykiss)
  • Length: 142
  • Sequence:
    • SLSAKDKANVKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003bom , Chain A 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003bom , Chain C 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00002r1h , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002r1h , Chain C 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB