Danish
Uniprot ID:  P14532
  • Protein: Cytochrome c551 peroxidase
  • Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
  • Length: 346
  • Sequence:
    • MQSSQLLPLGSLLLSFATPLAQADALHDQASALFKPIPEQVTELRGQPISEQQRELGKKLFFDPRLSRSHVLSCNTCHNVGTGGADNVPTSVGHGWQKGPRNSPTVFNAVFNAAQFWDGRAKDLGEQAKGPIQNSVEMHSTPQLVEQTLGSIPEYVDAFRKAFPKAGKPVSFDNMALAIEAYEATLVTPDSPFDLYLKGDDKALDAQQKKGLKAFMDSGCSACHNGINLGGQAYFPFGLVKKPDASVLPSGDKGRFAVTKTQSDEYVFRAAPLRNVALTAPYFHSGQVWELKDAVAIMGNAQLGKQLAPDDVENIVAFLHSLSGKQPRVEYPLLPASTETTPRPAE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00002vhd , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-323 (24-346), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A23
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D ,  C
Available structure PDB
PDB ID:  pdb_00002vhd , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-323 (24-346), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A23
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G ,  F
Available structure PDB
PDB ID:  pdb_00001eb7 , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-323 (24-346), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A23
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 223SER-228GLY
Structural gaps Exists
label_asym_ids of heme C ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00001eb7 , Chain A-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-323 (24-346), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A23
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 223SER-228GLY
Structural gaps Exists
label_asym_ids of heme C-1 ,  B-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å