Danish
Uniprot ID:  P14548
  • Protein: Cytochrome b
  • Organism: Sauroleishmania tarentolae (Leishmania tarentolae)
  • Length: 371
  • Sequence:
    • MFFRVRFLLFFLLFRNLCCLLTSGCLLRVYGVGFSLGFFICMQIICGVCLAWLFFSCFICTNWYFVLFLWDFDLGFVIRSTHICFTSLLFFLLYVHIFKCIVLIILFDTHILVWAVGFIIYIFIVVIGFIGYVLPCTMMSYWGLTVFSNILATVPVIGTWLCYWIWGSEYINDFTLLKLHVLHVLLPFVLILVIFMHLFCLHYFMSSDGFCDRFAFYCERLCFCMWFYLRDMFLAFLILFYVVYFIFINWYFVFHEESWVIVDTLKTSDKILPEWFFLFLFGFLKAVPDKFTGLLLMVILLFSLFLFILNCILWFVYCRSSLLWFTYSLILFYSIFMSGFLALYVILAYPIWMELQFWVLLLFMLVVCRLD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00009z9k , Chain D 
Resolution 3.02 Å
Residue indices (Uniprot), coverage 1-371 (1-371), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme Y ,  Z
Available structure PDB
PDB ID:  pdb_00009z9k , Chain O 
Resolution 3.02 Å
Residue indices (Uniprot), coverage 1-371 (1-371), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id d
label_asym_ids of heme AA ,  BA
Available structure PDB