Danish
Uniprot ID:  P14774
  • Protein: Cytochrome c-L
  • Organism: Methylobacterium extorquens (Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1))
  • Length: 197
  • Sequence:
    • MMNRVKIGTALLGLTLAGIALPALAQPQSGPQTGVVFRNTVTGEALDVSQGKEGGRDTPAVKKFLETGENLYIDDKSCLRNGESLFATSCSGCHGHLAEGKLGPGLNDNYWTYPSNTTDVGLFATIFGGANGMMGPHNENLTPDEMLQTIAWIRHLYTGPKQDAVWLNDEQKKAYTPYKQGEVIPKDAKGQCKPLDE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00002c8s , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 24-172 (26-197), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB