Danish
Uniprot ID:  P15160
  • Protein: Group 1 truncated hemoglobin trHbN
  • Organism: Paramecium caudatum
  • Length: 117
  • Sequence:
    • MSLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTV
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001dlw , Chain A 
Resolution 1.54 Å
Residue indices (Uniprot), coverage 1-116 (2-117), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001uvy , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-116 (2-117), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB