Danish

Uniprot ID: P15447

MGLSAAQRQVVASTWKDIAGSDNGAGVGKECFTKFLSAHHDIAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGYKHIKAEYFEPLGASLLSAMEHRIGGKMTAAAKDAWAAAYADISGALISGLQS

Number of chains: 4

PDB ID: 1jf4 , Chain A
Resolution	1.40 Å
Residue indices (Uniprot), coverage	1-147 (2-148), 0.99
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1jl6 , Chain A
Resolution	1.40 Å
Residue indices (Uniprot), coverage	1-147 (2-148), 0.99
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1vre , Chain A
Residue indices (Uniprot), coverage	1-147 (2-148), 0.99
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1vrf , Chain A
Residue indices (Uniprot), coverage	1-147 (2-148), 0.99
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB