Danish
Uniprot ID:  P15447
  • Protein: Globin, monomeric component M-IV
  • Organism: Bloodworm (Glycera dibranchiata)
  • Length: 148
  • Sequence:
    • MGLSAAQRQVVASTWKDIAGSDNGAGVGKECFTKFLSAHHDIAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGYKHIKAEYFEPLGASLLSAMEHRIGGKMTAAAKDAWAAAYADISGALISGLQS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001jf4 , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Mutations (UniProt numbering) I42M, Y96N, T124N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9796
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001jl6 , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Mutations (UniProt numbering) I42M, Y96N, T124N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9796
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001vre , Chain A 
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Mutations (UniProt numbering) I42M, Y96N, T124N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9796
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001vrf , Chain A 
Residue indices (Uniprot), coverage 1-147 (2-148), 0.99
Mutations (UniProt numbering) I42M, Y96N, T124N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9796
auth_asym_id A
label_asym_ids of heme B
Available structure PDB