Danish
Uniprot ID:  P22830
  • Protein: Ferrochelatase, mitochondrial
  • Organism: Human (Homo sapiens)
  • Length: 423
  • Sequence:
    • MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  14
PDB ID:  pdb_00003hcn , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.85
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K64
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00003hcn , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 565-923 (65-423), 0.85
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K64
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00003hco , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.85
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K64
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00003hco , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 565-923 (65-423), 0.85
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K64
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00004klr , Chain A 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.87
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A56G, K57S, P58H, Q59H, V60H, Q61H, P62H, Q63H, K64G, E343Q
Insertions None
Deletions R2-Q54
Sequence identity to UniProt 0.9730
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00004klr , Chain B 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.87
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A56G, K57S, P58H, Q59H, V60H, Q61H, P62H, Q63H, K64G, E343Q
Insertions None
Deletions R2-Q54
Sequence identity to UniProt 0.9730
auth_asym_id B
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00002qd2 , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.85
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F110A
Insertions None
Deletions M1-K64
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00002qd2 , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.85
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F110A
Insertions None
Deletions M1-K64
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00002qd3 , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.85
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K64
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00002qd3 , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 565-923 (65-423), 0.85
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K64
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00004klc , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.87
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A56G, K57S, P58H, Q59H, V60H, Q61H, P62H, Q63H, K64G, F110A, E343D
Insertions None
Deletions R2-Q54
Sequence identity to UniProt 0.9703
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00004klc , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.87
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A56G, K57S, P58H, Q59H, V60H, Q61H, P62H, Q63H, K64G, F110A, E343D
Insertions None
Deletions R2-Q54
Sequence identity to UniProt 0.9703
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00004kmm , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.87
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A56G, K57S, P58H, Q59H, V60H, Q61H, P62H, Q63H, K64G, M76H
Insertions None
Deletions R2-Q54
Sequence identity to UniProt 0.9730
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004kmm , Chain B 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 65-423 (65-423), 0.87
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A56G, K57S, P58H, Q59H, V60H, Q61H, P62H, Q63H, K64G, M76H
Insertions None
Deletions R2-Q54
Sequence identity to UniProt 0.9730
auth_asym_id B
label_asym_ids of heme H
Available structure PDB