- Protein: Cytochrome b
- Organism: Sheep (Ovis aries)
- Length: 379
- Sequence:
MINIRKTHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTPDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRGLYYGSYTFLETWNIGVILLFATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFIFPFIIAALAMVHLLFLHETGSNNPTGIPSDTDKIPFHPYYTIKDILGAILLILILMLLVLFTPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILVLVIMPLLHTSKQRSMMFRPISQCMFWILVADLLTLTWIGGQPVEHPYIIIGQLASIMYFLIILVMMPVASIIENNLLKW
| Resolution | 5.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-379 (2-379), 1.00 |
| auth_asym_id | AC |
| label_asym_ids of heme | TC , UC , XC |
| Available structure | PDB |
| Resolution | 5.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-379 (2-379), 1.00 |
| auth_asym_id | AN |
| label_asym_ids of heme | XC , YC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (2-379), 1.00 |
|---|---|
| auth_asym_id | AC |
| label_asym_ids of heme | TC , UC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (2-379), 1.00 |
|---|---|
| auth_asym_id | AN |
| label_asym_ids of heme | XC , YC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (2-379), 1.00 |
|---|---|
| auth_asym_id | AC |
| label_asym_ids of heme | GC , HC , KC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (2-379), 1.00 |
|---|---|
| auth_asym_id | AN |
| label_asym_ids of heme | KC , LC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b1 |
| label_asym_ids of heme | U , V |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b2 |
| label_asym_ids of heme | FA , GA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b1 |
| label_asym_ids of heme | NB , OB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b2 |
| label_asym_ids of heme | RB , SB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b1 |
| label_asym_ids of heme | SB , TB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b2 |
| label_asym_ids of heme | XB , YB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b1 |
| label_asym_ids of heme | NB , OB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-379 (1-379), 1.00 |
|---|---|
| auth_asym_id | b2 |
| label_asym_ids of heme | SB , TB |
| Available structure | PDB |