Danish
Uniprot ID:  P30627
  • Protein: Globin-like protein
  • Organism: Caenorhabditis elegans
  • Length: 159
  • Sequence:
    • MSMNRQEISDLCVKSLEGRMVGTEAQNIENGNAFYRYFFTNFPDLRVYFKGAEKYTADDVKKSERFDKQGQRILLACHLLANVYTNEEVFKGYVRETINRHRIYKMDPALWMAFFTVFTGYLESVGCLNDQQKAAWMALGKEFNAESQTHLKNSNLPHV
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00002wtg , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 2-159 (1-159), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C127S
Insertions None
Deletions None
Sequence identity to UniProt 0.9937
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002wtg , Chain A-1 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 2-159 (1-159), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C127S
Insertions None
Deletions None
Sequence identity to UniProt 0.9937
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00002wth , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 2-159 (1-159), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C127S
Insertions None
Deletions None
Sequence identity to UniProt 0.9937
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002wth , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 2-159 (1-159), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C127S
Insertions None
Deletions None
Sequence identity to UniProt 0.9937
auth_asym_id B
label_asym_ids of heme H
Available structure PDB