Danish
Uniprot ID:  P44654
  • Protein: Periplasmic nitrate reductase, electron transfer subunit
  • Organism: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
  • Length: 150
  • Sequence:
    • MINMTKQVSKILAGLFTALFAGSLMASDAPAVGKDLTQAAENIPPAFHNAPRQGELPALNYVNQPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVGSSSSPRRYFCLQCHVSQANVDPIVPNDFKPMKGYGN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00001jni , Chain A 
Resolution 1.25 Å
Residue indices (Uniprot), coverage 38-104 (28-150), 0.82
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S27
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 88GLY-92SER
Structural gaps Exists
label_asym_ids of heme C ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å