Danish
Uniprot ID:  P56310
  • Protein: Cytochrome b559 subunit beta
  • Organism: Green alga (Chlorella vulgaris)
  • Length: 41
  • Sequence:
    • MTARKSYTYPIFTVRWLAVHALAVPTVFFLGAITAMQFIQR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00008bd3 , Chain L 
Residue indices (Uniprot), coverage 8-44 (5-41), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-R4
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme KJ
Available structure PDB
PDB ID:  pdb_00008bd3 , Chain PA 
Residue indices (Uniprot), coverage 8-44 (5-41), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-R4
Sequence identity to UniProt 1.0000
auth_asym_id f
label_asym_ids of heme GW
Available structure PDB