Danish
Uniprot ID:  P57736
  • Protein: Cytochrome c6
  • Organism: Green alga (Tetradesmus obliquus)
  • Length: 89
  • Sequence:
    • SADLALGKQTFEANCAACHAGGNNSVIPDHTLRKAAMEQFLQGGFNLEAITYQVENGKGAMPAWSGTLDDDEIAAVAAYVYDQASGDKW
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00001c6r , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-89 (1-89), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001c6o , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-89 (1-89), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001c6o , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-89 (1-89), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB