Danish
Uniprot ID:  P62894
  • Protein: Cytochrome c
  • Organism: Bovine (Bos taurus)
  • Length: 105
  • Sequence:
    • MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  17
PDB ID:  pdb_00002b4z , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006ff5 , Chain A 
Resolution 1.74 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002ybb , Chain GA 
Resolution 19.00 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id Y
label_asym_ids of heme DC
Available structure PDB
PDB ID:  pdb_00003j2t , Chain H 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id H
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00003j2t , Chain I 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id I
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00003j2t , Chain J 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id J
label_asym_ids of heme X
Available structure PDB
PDB ID:  pdb_00003j2t , Chain K 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id K
label_asym_ids of heme Y
Available structure PDB
PDB ID:  pdb_00003j2t , Chain L 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id L
label_asym_ids of heme Z
Available structure PDB
PDB ID:  pdb_00003j2t , Chain M 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id M
label_asym_ids of heme AA
Available structure PDB
PDB ID:  pdb_00003j2t , Chain N 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id N
label_asym_ids of heme BA
Available structure PDB
PDB ID:  pdb_00005juy , Chain H 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id H
label_asym_ids of heme Z
Available structure PDB
PDB ID:  pdb_00005juy , Chain I 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id I
label_asym_ids of heme AA
Available structure PDB
PDB ID:  pdb_00005juy , Chain J 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id J
label_asym_ids of heme BA
Available structure PDB
PDB ID:  pdb_00005juy , Chain K 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id K
label_asym_ids of heme CA
Available structure PDB
PDB ID:  pdb_00005juy , Chain L 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id L
label_asym_ids of heme DA
Available structure PDB
PDB ID:  pdb_00005juy , Chain M 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id M
label_asym_ids of heme EA
Available structure PDB
PDB ID:  pdb_00005juy , Chain N 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id N
label_asym_ids of heme FA
Available structure PDB