- Protein: Cytochrome c
- Organism: Bovine (Bos taurus)
- Length: 105
- Sequence:
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.74 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 19.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
| auth_asym_id | Y |
| label_asym_ids of heme | DC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | H |
| label_asym_ids of heme | V |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | I |
| label_asym_ids of heme | W |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | J |
| label_asym_ids of heme | X |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | K |
| label_asym_ids of heme | Y |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | L |
| label_asym_ids of heme | Z |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | M |
| label_asym_ids of heme | AA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | N |
| label_asym_ids of heme | BA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | H |
| label_asym_ids of heme | Z |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | I |
| label_asym_ids of heme | AA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | J |
| label_asym_ids of heme | BA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | K |
| label_asym_ids of heme | CA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | L |
| label_asym_ids of heme | DA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | M |
| label_asym_ids of heme | EA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
|---|---|
| auth_asym_id | N |
| label_asym_ids of heme | FA |
| Available structure | PDB |