Danish
Uniprot ID:  P68168
  • Protein: Anaerobic nitrite reductase
  • Organism: Sponia andersonii (Parasponia andersonii)
  • Length: 162
  • Sequence:
    • MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGVAYDQLVAAIKFEMKPSST
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003qqr , Chain A 
Resolution 2.16 Å
Residue indices (Uniprot), coverage 9-159 (1-162), 1.00
Mutations (UniProt numbering) A91V
Insertions None
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 56ASP-59VAL:61LEU-61LEU
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00003qqr , Chain B 
Resolution 2.16 Å
Residue indices (Uniprot), coverage 9-159 (1-162), 1.00
Mutations (UniProt numbering) A91V
Insertions None
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id B
Missing residues 56ASP-56ASP:58PRO-58PRO:60PRO-60PRO
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.18 Å