Danish
Uniprot ID:  P73925
  • Protein: Group 1 truncated hemoglobin GlbN
  • Organism: Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
  • Length: 124
  • Sequence:
    • MSTLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDVLNQ
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  7
PDB ID:  pdb_00001s69 , Chain A 
Resolution 1.68 Å
Residue indices (Uniprot), coverage 2-124 (1-124), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001s6a , Chain A 
Resolution 1.69 Å
Residue indices (Uniprot), coverage 2-124 (1-124), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001rtx , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002hz1 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002hz3 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) H117A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9919
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002hz2 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) H117A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9919
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001mwb , Chain A 
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB