Danish
Uniprot ID:  P76536
  • Protein: Dye-decolorizing peroxidase YfeX
  • Organism: Escherichia coli (strain K12)
  • Length: 299
  • Sequence:
    • MSQVQSGILPEHCRAAIWIEANVKGEVDALRAASKTFADKLATFEAKFPDAHLGAVVAFGNNTWRALSGGVGAEELKDFPGYGKGLAPTTQFDVLIHILSLRHDVNFSVAQAAMEAFGDCIEVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVHDQEMVIGRTKEANEEIDGDERPETSHLTRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLHNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLDKLMAL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00005gt2 , Chain A 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 4-300 (1-299), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V194M
Insertions 299insLEHHHHHH
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005gt2 , Chain B 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 4-300 (1-299), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V194M
Insertions 299insLEHHHHHH
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00005gt2 , Chain C 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 4-300 (1-299), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V194M
Insertions 299insLEHHHHHH
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00005gt2 , Chain D 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 4-300 (1-299), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V194M
Insertions 299insLEHHHHHH
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id D
label_asym_ids of heme H
Available structure PDB