Danish
Uniprot ID:  P77872
  • Protein: Catalase
  • Organism: Campylobacter pylori (Helicobacter pylori (strain ATCC 700392 / 26695))
  • Length: 505
  • Sequence:
    • MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPDSNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELNKNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPRCPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRADDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVKKALEKHQKMMKDMHGKDMHHTKKKK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  20
PDB ID:  pdb_00001qwl , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001qwl , Chain A-1 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00001qwl , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001qwl , Chain B-1 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00001qwm , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-490 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001qwm , Chain A-1 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-490 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
label_asym_ids of heme D-1
Available structure PDB
PDB ID:  pdb_00001qwm , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-490 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
label_asym_ids of heme Z
Available structure PDB
PDB ID:  pdb_00001qwm , Chain B-1 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-490 (1-505), 1.00
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
label_asym_ids of heme Z-1
Available structure PDB
PDB ID:  pdb_00002a9e , Chain A 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002a9e , Chain A-1 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme D-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002a9e , Chain B 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002a9e , Chain B-1 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme F-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002iqf , Chain A 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence conflict:modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002iqf , Chain A-1 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence conflict:modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id A
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme D-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002iqf , Chain B 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence conflict:modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002iqf , Chain B-1 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-491 (1-505), 1.00
Difference from Uniprot sequence conflict:modified residue
Mutations (UniProt numbering) V234I, Y237H, N248D, F255Y, L286T, S316T
Insertions None
Deletions None
Sequence identity to UniProt 0.9881
auth_asym_id B
Missing residues 162MET-162MET:181MET-181MET:292MET-292MET:372MET-372MET
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme F-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009nh3 , Chain A 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 4-491 (1-505), 1.00
Mutations (UniProt numbering) N248D, L286T, S316T, D421E
Insertions None
Deletions None
Sequence identity to UniProt 0.9921
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009nh3 , Chain A-1 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 4-491 (1-505), 1.00
Mutations (UniProt numbering) N248D, L286T, S316T, D421E
Insertions None
Deletions None
Sequence identity to UniProt 0.9921
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00009nh3 , Chain B 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 2-491 (1-505), 1.00
Mutations (UniProt numbering) N248D, L286T, S316T, D421E
Insertions None
Deletions None
Sequence identity to UniProt 0.9921
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00009nh3 , Chain B-1 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 2-491 (1-505), 1.00
Mutations (UniProt numbering) N248D, L286T, S316T, D421E
Insertions None
Deletions None
Sequence identity to UniProt 0.9921
auth_asym_id B
label_asym_ids of heme H-1
Available structure PDB