Danish
Uniprot ID:  P80017
  • Protein: Globin D, coelomic
  • Organism: Sea cucumber (Molpadia arenicola)
  • Length: 159
  • Sequence:
    • MGATQSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQMAGLSPAELRTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQVHDAWAKTFAIVQGVLITKHAS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001hlm , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-158 (2-159), 1.00
Mutations (UniProt numbering) M1X
Insertions None
Deletions None
Sequence identity to UniProt 0.9937
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001hlm , Chain A-1 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-158 (2-159), 1.00
Mutations (UniProt numbering) M1X
Insertions None
Deletions None
Sequence identity to UniProt 0.9937
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB