Danish

Uniprot ID: P81238

Protein: Cytochrome c-type protein SHP
Organism: Rhodobacter sphaeroides (Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.))
Length: 129
Sequence:

MTRFLILSAVLAGPALAGDTSPAQLIAGYEAAAGAPADAERGRALFLSTQTGGKPDTPSCTTCHGADVTRAGQTRTGKEIAPLAPSATPDRFTDSARVEKWLGRNCNSVIGRDCTPGEKADLLAWLAAQ

Number of chains: 12

PDB ID: 1dw0 , Chain A
Resolution	1.82 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1dw0 , Chain B
Resolution	1.82 Å
Residue indices (Uniprot), coverage	2-112 (18-129), 0.87
auth_asym_id	B
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 1dw0 , Chain C
Resolution	1.82 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	C
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 1dw1 , Chain A
Resolution	1.90 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1dw1 , Chain B
Resolution	1.90 Å
Residue indices (Uniprot), coverage	2-112 (18-129), 0.87
auth_asym_id	B
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 1dw1 , Chain C
Resolution	1.90 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 1dw3 , Chain A
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	A
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1dw3 , Chain B
Resolution	2.10 Å
Residue indices (Uniprot), coverage	2-112 (18-129), 0.87
auth_asym_id	B
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1dw3 , Chain C
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	C
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1dw2 , Chain A
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	A
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1dw2 , Chain B
Resolution	2.20 Å
Residue indices (Uniprot), coverage	2-112 (18-129), 0.87
auth_asym_id	B
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1dw2 , Chain C
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-112 (18-129), 0.87
auth_asym_id	C
label_asym_ids of heme	H
Available structure	PDB