Uniprot ID: P81459
- Protein: Cytochrome c
- Organism: Albacore (Thunnus alalunga)
- Length: 103
- Sequence:
GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS
Number of chains: 7
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-103 (1-103), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-103 (1-103), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-103 (1-103), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | 0insX |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | R |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-103 (1-103), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | 0insX |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | O |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-103 (1-103), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | 0insX |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | I |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-103 (1-103), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-103 (1-103), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |