Danish
Uniprot ID:  P82291
  • Protein: Soluble cytochrome b558
  • Organism: Ectothiorhodospira vacuolata (Ectothiorhodospira shaposhnikovii)
  • Length: 91
  • Sequence:
    • MNETEATLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYGEPHSSLAARLLQRYLIGTLEEIT
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00001cxy , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 6-86 (2-91), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB