Danish
Uniprot ID:  P83134
  • Protein: Hemoglobin D subunit alpha
  • Organism: Aldabra giant tortoise (Aldabrachelys gigantea)
  • Length: 141
  • Sequence:
    • MLTEDDKQLIQHVWEKVLEHQEDFGAEALERMFIVYPSTKTYFPHFDLHHDSEQIRHHGKKVVGALGDAVKHIDNLSATLSELSNLHAYNLRVDPVNFKLLSHCFQVVLGAHLGREYTPQVQVAYDKFLAAVSAVLAEKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00001wmu , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001wmu , Chain A-1 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00002z6n , Chain A 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002z6n , Chain A-1 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00001v75 , Chain A 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001v75 , Chain A-1 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB