Danish
Uniprot ID:  P83787
  • Protein: Cytochrome c peroxidase
  • Organism: Marinobacter hydrocarbonoclasticus (Marinobacter nauticus)
  • Length: 326
  • Sequence:
    • DNLMERANSMFEPIPKYPPVIDGNELTQAKVELGKMEFFEPRLSSSHLISCNTCHNVGLGGDDELPTSIGHGWQKGPRNSPTVFNAVFNAAQFWDGRAADLAEQAKGPVQAGVEMSSTPDRVVATLKSMPEYIERFEDAFPGQENPVTFDNMAVAIEAYEATLITPEAPFDKYLRGDTSALNESEKEGLALFMDRGCTACHSGVNLGGQNYYPFGLVAKPGAEILPEGDKGRFSVTETASDEYVFRASPLRNIELTAPYFHSGAVWSLEEAVAVMGTAQLGTELNNDEVKSIVAFLKTLTGNVPEVTYPVLPPSTANTPKPVDMIP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00001nml , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-326 (1-326), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 220PRO-229ASP
Structural gaps Exists
label_asym_ids of heme C ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00001rz6 , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-322 (1-326), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 220PRO-229ASP
Structural gaps Exists
label_asym_ids of heme C ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00001rz5 , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-326 (1-326), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 98ALA-104GLN:220PRO-229ASP
Structural gaps Exists
label_asym_ids of heme D ,  C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å