- Protein: Peroxynitrite isomerase 1
- Organism:
- Length: 164
- Sequence:
MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR
| Resolution | 1.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-164 (1-164), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-164 (1-164), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |