Uniprot ID: P9WKH3
- Protein: Heme oxygenase (mycobilin-producing)
- Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Length: 105
- Sequence:
MPVVKINAIEVPAGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVKGEERYFVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLDVGGTGKTA
Number of chains: 6
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-102 (1-105), 1.00 |
| Difference from Uniprot sequence | expression tag |
| Mutations (UniProt numbering) | None |
| Insertions | 105insGGVPRGKLAAALEHHHHHH |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-99 (1-105), 1.00 |
| Difference from Uniprot sequence | expression tag |
| Mutations (UniProt numbering) | None |
| Insertions | 105insGGVPRGKLAAALEHHHHHH |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-102 (1-105), 1.00 |
| Difference from Uniprot sequence | expression tag |
| Mutations (UniProt numbering) | None |
| Insertions | 105insGVPRGKLAAALEHHHHHH |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-101 (1-105), 1.00 |
| Difference from Uniprot sequence | expression tag |
| Mutations (UniProt numbering) | None |
| Insertions | 105insGVPRGKLAAALEHHHHHH |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (2-100), 0.94 |
| Difference from Uniprot sequence | engineered mutation |
| Mutations (UniProt numbering) | R26S |
| Insertions | None |
| Deletions | M1, T101-A105 |
| Sequence identity to UniProt | 0.9899 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (2-100), 0.94 |
| Difference from Uniprot sequence | engineered mutation |
| Mutations (UniProt numbering) | R26S |
| Insertions | None |
| Deletions | M1, T101-A105 |
| Sequence identity to UniProt | 0.9899 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |