Danish
Uniprot ID:  P9WPN5
  • Protein: Cytochrome P450 130
  • Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
  • Length: 405
  • Sequence:
    • MTSVMSHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHADVWSAARDHQTFSSAQGLTVNYGELEMIGLHDTPPMVMQDPPVHTEFRKLVSRGFTPRQVETVEPTVRKFVVERLEKLRANGGGDIVTELFKPLPSMVVAHYLGVPEEDWTQFDGWTQAIVAANAVDGATTGALDAVGSMMAYFTGLIERRRTEPADDAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLHRRPDQRRLLLDDPEGIPDAVEELLRLTSPVQGLARTTTRDVTIGDTTIPAGRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHCLGAAAARMQCRVALTELLARCPDFEVAESRIVWSGGSYVRRPLSVPFRVTS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  12
PDB ID:  pdb_00002uuq , Chain A 
Resolution 1.46 Å
Residue indices (Uniprot), coverage 6-404 (1-405), 1.00
Mutations (UniProt numbering) None
Insertions 0insMHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 180ASP-184THR
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002uuq , Chain A-1 
Resolution 1.46 Å
Residue indices (Uniprot), coverage 6-404 (1-405), 1.00
Mutations (UniProt numbering) None
Insertions 0insMHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 180ASP-184THR
Structural gaps Exists
label_asym_ids of heme B-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002wgy , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-404 (2-405), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G243A
Insertions 1insHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 0.9975
auth_asym_id A
Missing residues 179VAL-184THR
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00002whf , Chain A 
Resolution 1.58 Å
Residue indices (Uniprot), coverage 6-404 (2-405), 1.00
Mutations (UniProt numbering) None
Insertions 1insHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 180ASP-184THR
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002wh8 , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 6-403 (2-405), 1.00
Mutations (UniProt numbering) None
Insertions 1insHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 179VAL-184THR
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002wh8 , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 6-403 (2-405), 1.00
Mutations (UniProt numbering) None
Insertions 1insHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 179VAL-184THR
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00002wh8 , Chain C 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 6-403 (2-405), 1.00
Mutations (UniProt numbering) None
Insertions 1insHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 177ASN-184THR:223ALA-224ASP
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00002wh8 , Chain D 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 6-403 (2-405), 1.00
Mutations (UniProt numbering) None
Insertions 1insHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 179VAL-184THR:222GLY-224ASP
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00002uvn , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 6-407 (1-405), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 178ALA-180ASP
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002uvn , Chain A-1 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 6-407 (1-405), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 178ALA-180ASP
Structural gaps Exists
label_asym_ids of heme C-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002uvn , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 7-404 (1-405), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 176ALA-182ALA
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00002uvn , Chain B-1 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 7-404 (1-405), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMHHHHHH, 405insSR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 176ALA-182ALA
Structural gaps Exists
label_asym_ids of heme L-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å