Danish
Uniprot ID:  Q02567
  • Protein: Manganese peroxidase 1
  • Organism: White-rot fungus (Phanerodontia chrysosporium)
  • Length: 378
  • Sequence:
    • MAFKSLIAFVALAAAVRAAPTAVCPDGTRVSHAACCAFIPLAQDLQETIFQNECGEDAHEVIRLTFHDAIAISRSQGPKAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFMQKHNTISAADLVQFAGAVALSNCPGAPRLEFLAGRPNKTIAAVDGLIPEPQDSVTKILQRFEDAGGFTPFEVVSLLASHSVARADKVDQTIDAAPFDSTPFTFDTQVFLEVLLKGVGFPGSANNTGEVASPLPLGSGSDTGEMRLQSDFALAHDPRTACIWQGFVNEQAFMAASFRAAMSKLAVLGHNRNSLIDCSDVVPVPKPATGQPAMFPASTGPQDLELSCPSERFPTLTTQPGASQSLIAHCPDGSMSCPGVQFNGPA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  9
PDB ID:  pdb_00003m5q , Chain A 
Resolution 0.93 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-T21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003m8m , Chain A 
Resolution 1.05 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-T21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001yyd , Chain A 
Resolution 1.45 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-T21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001yyg , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-T21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001yzp , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-T21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001yzr , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-T21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001mn1 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D200N
Insertions None
Deletions M1-T21
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001mn2 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E56Q, D200N
Insertions None
Deletions M1-T21
Sequence identity to UniProt 0.9944
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001mnp , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-357 (22-378), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-T21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB