Danish
Uniprot ID:  Q09128
  • Protein: 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  • Organism: Rat (Rattus norvegicus)
  • Length: 514
  • Sequence:
    • MSCPIDKRRTLIAFLRRLRDLGQPPRSVTSKASASRAPKEVPLCPLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFLERMDELCDERGRIPDLYSELNKWSFESICLVLYEKRFGLLQKETEEEALTFITAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDNRLQRYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQAQRRLLQEVQSVLPDNQTPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYALPKGTVLTLNTQVLGSSEDNFEDSHKFRPERWLQKEKKINPFAHLPFGIGKRMCIGRRLAELQLHLALCWIIQKYDIVATDNEPVEMLHLGILVPSRELPIAFRPR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003k9v , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 51-514 (34-514), 0.94
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S57D
Insertions None
Deletions S2-S33
Sequence identity to UniProt 0.9979
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003k9v , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 51-514 (34-514), 0.94
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S57D
Insertions None
Deletions S2-S33
Sequence identity to UniProt 0.9979
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003k9y , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 54-514 (34-514), 0.94
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S57D
Insertions None
Deletions S2-S33
Sequence identity to UniProt 0.9979
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003k9y , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 53-514 (34-514), 0.94
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S57D
Insertions None
Deletions S2-S33
Sequence identity to UniProt 0.9979
auth_asym_id B
label_asym_ids of heme F
Available structure PDB